Lineage for d1v5ua1 (1v5u A:8-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803284Protein SET binding factor 1, Sbf1 [110260] (1 species)
  7. 2803285Species Mouse (Mus musculus) [TaxId:10090] [110261] (1 PDB entry)
    Uniprot Q8K2Z0 256-367
  8. 2803286Domain d1v5ua1: 1v5u A:8-111 [108386]
    Other proteins in same PDB: d1v5ua2, d1v5ua3
    Structural genomics target

Details for d1v5ua1

PDB Entry: 1v5u (more details)

PDB Description: solution structure of the c-terminal pleckstrin homology domain of sbf1 from mouse
PDB Compounds: (A:) SET binding factor 1

SCOPe Domain Sequences for d1v5ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ua1 b.55.1.1 (A:8-111) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]}
rsyegilykkgafmkpwkarwfvldktkhqlryydhrmdteckgvidlaeveavapgtpt
igapktvdekaffdvkttrrvynfcaqdvpsaqqwvdriqscls

SCOPe Domain Coordinates for d1v5ua1:

Click to download the PDB-style file with coordinates for d1v5ua1.
(The format of our PDB-style files is described here.)

Timeline for d1v5ua1: