Lineage for d1v5ta1 (1v5t A:8-84)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. Protein 8430435i17rik protein [110798] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [110799] (1 PDB entry)
    Uniprot Q8BGR9 3-79
  8. Domain d1v5ta1: 1v5t A:8-84 [108385]
    Other proteins in same PDB: d1v5ta2, d1v5ta3
    Structural genomics target

Details for d1v5ta1

PDB Entry: 1v5t (more details)

PDB Description: Solution Structure of the Ubiquitin-like Domain from Mouse Hypothetical 8430435I17Rik Protein
PDB Compounds: (A:) 8430435I17Rik Protein

SCOPe Domain Sequences for d1v5ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ta1 d.15.1.1 (A:8-84) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]}
lpiivkwggqeysvttlseddtvldlkqflktltgvlperqkllglkvkgkpaendvklg
alklkpntkimmmgtre

SCOPe Domain Coordinates for d1v5ta1 are not available.

Timeline for d1v5ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v5ta2, d1v5ta3