![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.6: KA1-like [103243] (3 families) ![]() contains a single copy of this fold |
![]() | Family d.129.6.1: Kinase associated domain 1, KA1 [103244] (2 proteins) Pfam PF02149 |
![]() | Protein Map/microtubule affinity-regulating kinase 3 [103245] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [103246] (2 PDB entries) Uniprot Q8C6G9 373-452 |
![]() | Domain d1v5sa1: 1v5s A:1-120 [108384] Other proteins in same PDB: d1v5sa2 Structural genomics target |
PDB Entry: 1v5s (more details)
SCOPe Domain Sequences for d1v5sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5sa1 d.129.6.1 (A:1-120) Map/microtubule affinity-regulating kinase 3 {Mouse (Mus musculus) [TaxId: 10090]} mkdhlihnvhkeehahahnkdydipttenlyfqgssgssgdmmreirkvlganncdyeqr erfllfcvhgdghaenlvqwemevcklprlslngvrfkrisgtsiafkniaskianelkl
Timeline for d1v5sa1: