Lineage for d1v5sa1 (1v5s A:1-120)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539572Superfamily d.129.6: KA1-like [103243] (3 families) (S)
    contains a single copy of this fold
  5. 2539573Family d.129.6.1: Kinase associated domain 1, KA1 [103244] (2 proteins)
    Pfam PF02149
  6. 2539574Protein Map/microtubule affinity-regulating kinase 3 [103245] (1 species)
  7. 2539575Species Mouse (Mus musculus) [TaxId:10090] [103246] (2 PDB entries)
    Uniprot Q8C6G9 373-452
  8. 2539577Domain d1v5sa1: 1v5s A:1-120 [108384]
    Other proteins in same PDB: d1v5sa2
    Structural genomics target

Details for d1v5sa1

PDB Entry: 1v5s (more details)

PDB Description: Solution structure of kinase associated domain 1 of mouse MAP/microtubule affinity-regulating kinase 3
PDB Compounds: (A:) MAP/microtubule affinity-regulating kinase 3

SCOPe Domain Sequences for d1v5sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5sa1 d.129.6.1 (A:1-120) Map/microtubule affinity-regulating kinase 3 {Mouse (Mus musculus) [TaxId: 10090]}
mkdhlihnvhkeehahahnkdydipttenlyfqgssgssgdmmreirkvlganncdyeqr
erfllfcvhgdghaenlvqwemevcklprlslngvrfkrisgtsiafkniaskianelkl

SCOPe Domain Coordinates for d1v5sa1:

Click to download the PDB-style file with coordinates for d1v5sa1.
(The format of our PDB-style files is described here.)

Timeline for d1v5sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v5sa2