Lineage for d1v5qa_ (1v5q A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558451Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 558452Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 558453Family b.36.1.1: PDZ domain [50157] (35 proteins)
    Pfam 00595
  6. 558478Protein Glutamate receptor interacting protein [82083] (2 species)
  7. 558479Species Mouse (Mus musculus) [TaxId:10090] [110177] (1 PDB entry)
  8. 558480Domain d1v5qa_: 1v5q A: [108383]
    Structural genomics target

Details for d1v5qa_

PDB Entry: 1v5q (more details)

PDB Description: solution structure of the pdz domain from mouse glutamate receptor interacting protein 1a-l (grip1) homolog

SCOP Domain Sequences for d1v5qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus)}
gssgssgagqvvhtettevvltadpvtgfgiqlqgsvfatetlsspplisyieadspaer
cgvlqigdrvmaingiptedstfeeanqllrdssitskvtleiefdvaesvipssgsgps
sg

SCOP Domain Coordinates for d1v5qa_:

Click to download the PDB-style file with coordinates for d1v5qa_.
(The format of our PDB-style files is described here.)

Timeline for d1v5qa_: