SCOP 1.69: Domain d1v5qa_: 1v5q A:

Lineage for d1v5qa_ (1v5q A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (29 proteins)
   Pfam 00595

6. Protein Glutamate receptor interacting protein [82083] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [110177] (1 PDB entry)

8. Domain d1v5qa_: 1v5q A: [108383]
   Structural genomics target

Details for d1v5qa_

PDB Entry: 1v5q

PDB Description: solution structure of the pdz domain from mouse glutamate receptor interacting protein 1a-l (grip1) homolog

SCOP Domain Sequences for d1v5qa_:

Sequence; same for both SEQRES and ATOM records:

>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus)}
gssgssgagqvvhtettevvltadpvtgfgiqlqgsvfatetlsspplisyieadspaer
cgvlqigdrvmaingiptedstfeeanqllrdssitskvtleiefdvaesvipssgsgps
sg

Timeline for d1v5qa_:

• d1v5qa_ is new in SCOP 1.69
  
• d1v5qa_ appears in SCOP 1.71
  
• d1v5qa_ appears in the current release, SCOPe 2.08, called d1v5qa1