Lineage for d1v5qa1 (1v5q A:8-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2785931Protein Glutamate receptor interacting protein [82083] (2 species)
  7. 2785932Species Mouse (Mus musculus) [TaxId:10090] [110177] (1 PDB entry)
    Uniprot Q925T6 461-570
  8. 2785933Domain d1v5qa1: 1v5q A:8-116 [108383]
    Other proteins in same PDB: d1v5qa2, d1v5qa3
    Structural genomics target

Details for d1v5qa1

PDB Entry: 1v5q (more details)

PDB Description: solution structure of the pdz domain from mouse glutamate receptor interacting protein 1a-l (grip1) homolog
PDB Compounds: (A:) Glutamate Receptor Interacting Protein 1A-L Homolog

SCOPe Domain Sequences for d1v5qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5qa1 b.36.1.1 (A:8-116) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]}
agqvvhtettevvltadpvtgfgiqlqgsvfatetlsspplisyieadspaercgvlqig
drvmaingiptedstfeeanqllrdssitskvtleiefdvaesvipssg

SCOPe Domain Coordinates for d1v5qa1:

Click to download the PDB-style file with coordinates for d1v5qa1.
(The format of our PDB-style files is described here.)

Timeline for d1v5qa1: