Lineage for d1v5pa1 (1v5p A:8-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803323Protein Tapp2 [110258] (1 species)
  7. 2803324Species Mouse (Mus musculus) [TaxId:10090] [110259] (1 PDB entry)
    Uniprot Q9ERS5 1-113
  8. 2803325Domain d1v5pa1: 1v5p A:8-120 [108382]
    Other proteins in same PDB: d1v5pa2, d1v5pa3
    Structural genomics target

Details for d1v5pa1

PDB Entry: 1v5p (more details)

PDB Description: solution structure of the n-terminal pleckstrin homology domain of tapp2 from mouse
PDB Compounds: (A:) pleckstrin homology domain-containing, family A

SCOPe Domain Sequences for d1v5pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5pa1 b.55.1.1 (A:8-120) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]}
mpyvdrqnricgfldiednensgkflrryfildtqancllwymdnpqnlavgagavgslq
ltyiskvsiatpkqkpktpfcfvinalsqryflqandqkdlkdwvealnqask

SCOPe Domain Coordinates for d1v5pa1:

Click to download the PDB-style file with coordinates for d1v5pa1.
(The format of our PDB-style files is described here.)

Timeline for d1v5pa1: