![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein 1700011n24rik protein [110796] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [110797] (1 PDB entry) Uniprot Q9DAF3 1-89 |
![]() | Domain d1v5oa1: 1v5o A:8-96 [108381] Other proteins in same PDB: d1v5oa2, d1v5oa3 Structural genomics target |
PDB Entry: 1v5o (more details)
SCOPe Domain Sequences for d1v5oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5oa1 d.15.1.1 (A:8-96) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} mlitvycvrrdltevtfslqvnpdfelsnfrvlcelesgvpaeeaqivymeqlltddhcs lgsyglkdgdmvvllqkdnvglrtpgrtp
Timeline for d1v5oa1: