Lineage for d1v5oa_ (1v5o A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402147Protein 1700011n24rik protein [110796] (1 species)
  7. 1402148Species Mouse (Mus musculus) [TaxId:10090] [110797] (1 PDB entry)
    Uniprot Q9DAF3 1-89
  8. 1402149Domain d1v5oa_: 1v5o A: [108381]
    Structural genomics target

Details for d1v5oa_

PDB Entry: 1v5o (more details)

PDB Description: solution structure of the ubiquitin-like domain from mouse hypothetical 1700011n24rik protein
PDB Compounds: (A:) 1700011N24Rik protein

SCOPe Domain Sequences for d1v5oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgmlitvycvrrdltevtfslqvnpdfelsnfrvlcelesgvpaeeaqivymeql
ltddhcslgsyglkdgdmvvllqkdnvglrtpgrtpsgpssg

SCOPe Domain Coordinates for d1v5oa_:

Click to download the PDB-style file with coordinates for d1v5oa_.
(The format of our PDB-style files is described here.)

Timeline for d1v5oa_: