Lineage for d1v5oa1 (1v5o A:8-96)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931199Protein 1700011n24rik protein [110796] (1 species)
  7. 2931200Species Mouse (Mus musculus) [TaxId:10090] [110797] (1 PDB entry)
    Uniprot Q9DAF3 1-89
  8. 2931201Domain d1v5oa1: 1v5o A:8-96 [108381]
    Other proteins in same PDB: d1v5oa2, d1v5oa3
    Structural genomics target

Details for d1v5oa1

PDB Entry: 1v5o (more details)

PDB Description: solution structure of the ubiquitin-like domain from mouse hypothetical 1700011n24rik protein
PDB Compounds: (A:) 1700011N24Rik protein

SCOPe Domain Sequences for d1v5oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5oa1 d.15.1.1 (A:8-96) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]}
mlitvycvrrdltevtfslqvnpdfelsnfrvlcelesgvpaeeaqivymeqlltddhcs
lgsyglkdgdmvvllqkdnvglrtpgrtp

SCOPe Domain Coordinates for d1v5oa1:

Click to download the PDB-style file with coordinates for d1v5oa1.
(The format of our PDB-style files is described here.)

Timeline for d1v5oa1: