![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.49: Cysteine-rich domain [57888] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) ![]() |
![]() | Family g.49.1.3: C1-like domain [111463] (1 protein) contains Pfam PF03107 (C1_2) and Pfam PF07649 (C1_3) |
![]() | Protein Pdi-like hypothetical protein At1g60420 [111464] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111465] (1 PDB entry) Uniprot O80763 Q8LB68 476-553 |
![]() | Domain d1v5na1: 1v5n A:8-83 [108380] Other proteins in same PDB: d1v5na2, d1v5na3 Structural genomics target complexed with zn |
PDB Entry: 1v5n (more details)
SCOPe Domain Sequences for d1v5na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5na1 g.49.1.3 (A:8-83) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} teerlkeieakydeiakdwpkkvkhvlheeheleltrvqvytcdkceeegtiwsyhcdec dfdlhakcalnedtke
Timeline for d1v5na1: