![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.55: PH domain-like [50728] (1 superfamily) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (9 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (24 proteins) |
![]() | Protein SH2 and PH domain-containing adapter protein APS [110256] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [110257] (1 PDB entry) |
![]() | Domain d1v5ma_: 1v5m A: [108379] Structural genomics target |
PDB Entry: 1v5m (more details)
SCOP Domain Sequences for d1v5ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus)} gssgssgnlaakvelvdiqregalrfmvaddaasgpggtaqwqkcrlllrravagerfrl effvppkasrpkvsiplsaiievrttmplempekdntfvlkvengaeyiletidslqkhs wvadiqgcvdsgpssg
Timeline for d1v5ma_: