![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
![]() | Protein SH2 and PH domain-containing adapter protein APS [110256] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [110257] (1 PDB entry) Uniprot Q9JID9 178-299 |
![]() | Domain d1v5ma1: 1v5m A:8-130 [108379] Other proteins in same PDB: d1v5ma2, d1v5ma3 Structural genomics target |
PDB Entry: 1v5m (more details)
SCOPe Domain Sequences for d1v5ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5ma1 b.55.1.1 (A:8-130) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} nlaakvelvdiqregalrfmvaddaasgpggtaqwqkcrlllrravagerfrleffvppk asrpkvsiplsaiievrttmplempekdntfvlkvengaeyiletidslqkhswvadiqg cvd
Timeline for d1v5ma1: