SCOP 1.73: Domain d1v5la_: 1v5l A:

Lineage for d1v5la_ (1v5l A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (46 proteins)
   Pfam PF00595

6. Protein Alpha-actinin-2 associated LIM protein [110178] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [110179] (1 PDB entry)

8. Domain d1v5la_: 1v5l A: [108378]
   Structural genomics target

Details for d1v5la_

PDB Entry: 1v5l

PDB Description: solution structure of pdz domain of mouse alpha-actinin-2 associated lim protein

PDB Compounds: (A:) PDZ and LIM domain 3; actinin alpha 2 associated LIM protein

SCOP Domain Sequences for d1v5la_:

Sequence; same for both SEQRES and ATOM records:

>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgnvvlpgpapwgfrlsggidfnqplvitritpgskaaaanlcpgdvilaidgfg
tesmthadaqdrikaasyqlclkidraetrlwspqvssgpssg

Timeline for d1v5la_:

• d1v5la_ first appeared in SCOP 1.69
  
• d1v5la_ appears in SCOP 1.71
  
• d1v5la_ appears in SCOP 1.75
  
• d1v5la_ appears in the current release, SCOPe 2.08, called d1v5la1