Lineage for d1v5la1 (1v5l A:8-97)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2785890Protein Alpha-actinin-2 associated LIM protein [110178] (1 species)
  7. 2785891Species Mouse (Mus musculus) [TaxId:10090] [110179] (1 PDB entry)
    Uniprot O70209 4-93
  8. 2785892Domain d1v5la1: 1v5l A:8-97 [108378]
    Other proteins in same PDB: d1v5la2, d1v5la3
    Structural genomics target

Details for d1v5la1

PDB Entry: 1v5l (more details)

PDB Description: solution structure of pdz domain of mouse alpha-actinin-2 associated lim protein
PDB Compounds: (A:) PDZ and LIM domain 3; actinin alpha 2 associated LIM protein

SCOPe Domain Sequences for d1v5la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5la1 b.36.1.1 (A:8-97) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]}
nvvlpgpapwgfrlsggidfnqplvitritpgskaaaanlcpgdvilaidgfgtesmtha
daqdrikaasyqlclkidraetrlwspqvs

SCOPe Domain Coordinates for d1v5la1:

Click to download the PDB-style file with coordinates for d1v5la1.
(The format of our PDB-style files is described here.)

Timeline for d1v5la1: