Lineage for d1v5ka1 (1v5k A:8-109)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325181Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2325182Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2325183Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 2325221Protein Microtubule-associated protein eb1, N-terminal microtubule binding domain [101194] (2 species)
    member of rp/eb family
  7. 2325230Species Mouse (Mus musculus) [TaxId:10090] [109829] (1 PDB entry)
    Uniprot Q61166 16-116
  8. 2325231Domain d1v5ka1: 1v5k A:8-109 [108377]
    Other proteins in same PDB: d1v5ka2, d1v5ka3
    Structural genomics target

Details for d1v5ka1

PDB Entry: 1v5k (more details)

PDB Description: solution structure of the ch domain from mouse eb-1
PDB Compounds: (A:) microtubule-associated protein, RP/EB family, member 1

SCOPe Domain Sequences for d1v5ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ka1 a.40.1.1 (A:8-109) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Mouse (Mus musculus) [TaxId: 10090]}
qrrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkvkfqakleheyiqn
fkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffd

SCOPe Domain Coordinates for d1v5ka1:

Click to download the PDB-style file with coordinates for d1v5ka1.
(The format of our PDB-style files is described here.)

Timeline for d1v5ka1: