SCOPe 2.06: Domain d1v5ka1: 1v5k A:8-109

Lineage for d1v5ka1 (1v5k A:8-109)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
   Pfam PF00307

6. Protein Microtubule-associated protein eb1, N-terminal microtubule binding domain [101194] (2 species)
   member of rp/eb family

7. Species Mouse (Mus musculus) [TaxId:10090] [109829] (1 PDB entry)
   Uniprot Q61166 16-116

8. Domain d1v5ka1: 1v5k A:8-109 [108377]
   Other proteins in same PDB: d1v5ka2, d1v5ka3
   Structural genomics target

Details for d1v5ka1

PDB Entry: 1v5k

PDB Description: solution structure of the ch domain from mouse eb-1

PDB Compounds: (A:) microtubule-associated protein, RP/EB family, member 1

SCOPe Domain Sequences for d1v5ka1:

Sequence; same for both SEQRES and ATOM records:

>d1v5ka1 a.40.1.1 (A:8-109) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Mouse (Mus musculus) [TaxId: 10090]}
qrrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkvkfqakleheyiqn
fkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffd

Timeline for d1v5ka1:

• d1v5ka1 first appeared in SCOP 1.69, called d1v5ka_
  
• d1v5ka1 was called d1v5ka_ in SCOPe 2.05
  
• d1v5ka1 appears in SCOPe 2.07
  
• d1v5ka1 appears in the current release, SCOPe 2.08