Lineage for d1v5ka_ (1v5k A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443178Fold a.40: CH domain-like [47575] (2 superfamilies)
    core: 4 helices: bundle
  4. 443179Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family) (S)
  5. 443180Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (9 proteins)
    Pfam 00307
  6. 443217Protein Microtubule-associated protein eb1, N-terminal microtubule binding domain [101194] (2 species)
    member of rp/eb family
  7. 443223Species Mouse (Mus musculus) [TaxId:10090] [109829] (1 PDB entry)
  8. 443224Domain d1v5ka_: 1v5k A: [108377]
    Structural genomics target

Details for d1v5ka_

PDB Entry: 1v5k (more details)

PDB Description: solution structure of the ch domain from mouse eb-1

SCOP Domain Sequences for d1v5ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ka_ a.40.1.1 (A:) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Mouse (Mus musculus)}
gssgssgqrrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkvkfqakl
eheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdsgpssg

SCOP Domain Coordinates for d1v5ka_:

Click to download the PDB-style file with coordinates for d1v5ka_.
(The format of our PDB-style files is described here.)

Timeline for d1v5ka_: