Lineage for d1v5ha_ (1v5h A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1253779Protein Cytoglobin [109626] (1 species)
  7. 1253780Species Human (Homo sapiens) [TaxId:9606] [109627] (8 PDB entries)
    Uniprot Q8WWM9 18-171
  8. 1253794Domain d1v5ha_: 1v5h A: [108375]
    complexed with hem

Details for d1v5ha_

PDB Entry: 1v5h (more details), 2.4 Å

PDB Description: Crystal Structure of Human Cytoglobin (Ferric Form)
PDB Compounds: (A:) cytoglobin

SCOPe Domain Sequences for d1v5ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ha_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}
eaerkavqamwarlyancedvgvailvrffvnfpsakqyfsqfkhmedplemerspqlrk
hacrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvaeefa
sdfppetqrawaklrgliyshvtaaykevgw

SCOPe Domain Coordinates for d1v5ha_:

Click to download the PDB-style file with coordinates for d1v5ha_.
(The format of our PDB-style files is described here.)

Timeline for d1v5ha_: