Lineage for d1v58b2 (1v58 B:2-61)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 500605Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 500811Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (1 family) (S)
  5. 500812Family d.17.3.1: DsbC/DsbG N-terminal domain-like [54424] (2 proteins)
  6. 500825Protein Thiol:disulfide interchange protein DsbG, N-terminal domain [110822] (1 species)
  7. 500826Species Escherichia coli [TaxId:562] [110823] (2 PDB entries)
  8. 500828Domain d1v58b2: 1v58 B:2-61 [108374]
    Other proteins in same PDB: d1v58a1, d1v58b1

Details for d1v58b2

PDB Entry: 1v58 (more details), 1.7 Å

PDB Description: Crystal Structure Of the Reduced Protein Disulfide Bond Isomerase DsbG

SCOP Domain Sequences for d1v58b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v58b2 d.17.3.1 (B:2-61) Thiol:disulfide interchange protein DsbG, N-terminal domain {Escherichia coli}
elpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekge

SCOP Domain Coordinates for d1v58b2:

Click to download the PDB-style file with coordinates for d1v58b2.
(The format of our PDB-style files is described here.)

Timeline for d1v58b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v58b1