Lineage for d1v58b2 (1v58 B:2-61)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936239Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families) (S)
  5. 2936240Family d.17.3.1: DsbC/DsbG N-terminal domain-like [54424] (3 proteins)
  6. 2936256Protein Thiol:disulfide interchange protein DsbG, N-terminal domain [110822] (1 species)
  7. 2936257Species Escherichia coli [TaxId:562] [110823] (5 PDB entries)
    Uniprot P77202
  8. 2936259Domain d1v58b2: 1v58 B:2-61 [108374]
    Other proteins in same PDB: d1v58a1, d1v58b1
    complexed with so4

Details for d1v58b2

PDB Entry: 1v58 (more details), 1.7 Å

PDB Description: Crystal Structure Of the Reduced Protein Disulfide Bond Isomerase DsbG
PDB Compounds: (B:) Thiol:disulfide interchange protein dsbG

SCOPe Domain Sequences for d1v58b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v58b2 d.17.3.1 (B:2-61) Thiol:disulfide interchange protein DsbG, N-terminal domain {Escherichia coli [TaxId: 562]}
elpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekge

SCOPe Domain Coordinates for d1v58b2:

Click to download the PDB-style file with coordinates for d1v58b2.
(The format of our PDB-style files is described here.)

Timeline for d1v58b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v58b1