SCOPe 2.08: Domain d1v57b1: 1v57 B:62-230

Lineage for d1v57b1 (1v57 B:62-230)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins)
   elaborated common fold

6. Protein Thiol:disulfide interchange protein DsbG, C-terminal domain [110610] (1 species)

7. Species Escherichia coli [TaxId:562] [110611] (5 PDB entries)
   Uniprot P77202

8. Domain d1v57b1: 1v57 B:62-230 [108369]
   Other proteins in same PDB: d1v57a2, d1v57b2
   complexed with so4

Details for d1v57b1

PDB Entry: 1v57, 2 Å

PDB Description: Crystal Structure of the Disulfide Bond Isomerase DsbG

PDB Compounds: (B:) Thiol:disulfide interchange protein dsbG

SCOPe Domain Sequences for d1v57b1:

Sequence; same for both SEQRES and ATOM records:

>d1v57b1 c.47.1.9 (B:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]}
nlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcpyckqfwqqarp
wvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvsteq
mkvlsdneklmddlganvtpaiyymskentlqqavglpdqktlniimgn

Timeline for d1v57b1:

• d1v57b1 first appeared in SCOP 1.69
  
• d1v57b1 appears in SCOPe 2.07