Lineage for d1v4xd_ (1v4x D:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632305Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 632316Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [109624] (3 PDB entries)
  8. 632320Domain d1v4xd_: 1v4x D: [108366]
    Other proteins in same PDB: d1v4xa_, d1v4xc_
    complexed with ace, hem

Details for d1v4xd_

PDB Entry: 1v4x (more details), 1.6 Å

PDB Description: Crystal structure of bluefin tuna hemoglobin deoxy form at pH5.0
PDB Compounds: (D:) hemoglobin beta chain

SCOP Domain Sequences for d1v4xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4xd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki
aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd
aftvetqcafqkflavvvfalgrkyh

SCOP Domain Coordinates for d1v4xd_:

Click to download the PDB-style file with coordinates for d1v4xd_.
(The format of our PDB-style files is described here.)

Timeline for d1v4xd_: