SCOP 1.69: Domain d1v4xd_: 1v4x D:

Lineage for d1v4xd_ (1v4x D:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (20 species)

7. Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [109624] (3 PDB entries)

8. Domain d1v4xd_: 1v4x D: [108366]
   Other proteins in same PDB: d1v4xa_, d1v4xc_

Details for d1v4xd_

PDB Entry: 1v4x, 1.6 Å

PDB Description: Crystal structure of bluefin tuna hemoglobin deoxy form at pH5.0

SCOP Domain Sequences for d1v4xd_:

Sequence; same for both SEQRES and ATOM records:

>d1v4xd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Bluefin tuna (Thunnus thynnus)}
vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki
aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd
aftvetqcafqkflavvvfalgrkyh

Timeline for d1v4xd_:

• d1v4xd_ is new in SCOP 1.69
  
• d1v4xd_ appears in SCOP 1.71
  
• d1v4xd_ appears in the current release, SCOPe 2.08