Lineage for d1v4xc_ (1v4x C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436191Protein Hemoglobin, alpha-chain [46486] (18 species)
  7. 436205Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [109623] (3 PDB entries)
  8. 436209Domain d1v4xc_: 1v4x C: [108365]
    Other proteins in same PDB: d1v4xb_, d1v4xd_

Details for d1v4xc_

PDB Entry: 1v4x (more details), 1.6 Å

PDB Description: Crystal structure of bluefin tuna hemoglobin deoxy form at pH5.0

SCOP Domain Sequences for d1v4xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4xc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Bluefin tuna (Thunnus thynnus)}
ttlsdkdkstvkalwgkisksadaigadalgrmlavypqtktyfshwpdmspgsgpvkah
gkkvmggvalavskiddlttglgdlselhafkmrvdpsnfkilshcilvvvakmfpkeft
pdahvsldkflasvalalaeryr

SCOP Domain Coordinates for d1v4xc_:

Click to download the PDB-style file with coordinates for d1v4xc_.
(The format of our PDB-style files is described here.)

Timeline for d1v4xc_: