Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (24 species) |
Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [109624] (3 PDB entries) Uniprot Q8AYM1 |
Domain d1v4xb_: 1v4x B: [108364] Other proteins in same PDB: d1v4xa_, d1v4xc_ complexed with hem |
PDB Entry: 1v4x (more details), 1.6 Å
SCOPe Domain Sequences for d1v4xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v4xb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]} vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd aftvetqcafqkflavvvfalgrkyh
Timeline for d1v4xb_: