SCOPe 2.05: Domain d1v4xb_: 1v4x B:

Lineage for d1v4xb_ (1v4x B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [109624] (3 PDB entries)
   Uniprot Q8AYM1

8. Domain d1v4xb_: 1v4x B: [108364]
   Other proteins in same PDB: d1v4xa_, d1v4xc_
   complexed with hem

Details for d1v4xb_

PDB Entry: 1v4x, 1.6 Å

PDB Description: Crystal structure of bluefin tuna hemoglobin deoxy form at pH5.0

PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1v4xb_:

Sequence; same for both SEQRES and ATOM records:

>d1v4xb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki
aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd
aftvetqcafqkflavvvfalgrkyh

Timeline for d1v4xb_:

• d1v4xb_ first appeared in SCOP 1.69
  
• d1v4xb_ appears in SCOPe 2.04
  
• d1v4xb_ appears in SCOPe 2.06
  
• d1v4xb_ appears in the current release, SCOPe 2.08