Lineage for d1v4wc_ (1v4w C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1976766Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 1976791Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [109623] (3 PDB entries)
    Uniprot Q8AYM0
  8. 1976795Domain d1v4wc_: 1v4w C: [108361]
    Other proteins in same PDB: d1v4wb_, d1v4wd_
    complexed with hem

Details for d1v4wc_

PDB Entry: 1v4w (more details), 1.7 Å

PDB Description: Crystal structure of bluefin tuna hemoglobin deoxy form at pH7.5
PDB Compounds: (C:) hemoglobin alpha chain

SCOPe Domain Sequences for d1v4wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4wc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
ttlsdkdkstvkalwgkisksadaigadalgrmlavypqtktyfshwpdmspgsgpvkah
gkkvmggvalavskiddlttglgdlselhafkmrvdpsnfkilshcilvvvakmfpkeft
pdahvsldkflasvalalaeryr

SCOPe Domain Coordinates for d1v4wc_:

Click to download the PDB-style file with coordinates for d1v4wc_.
(The format of our PDB-style files is described here.)

Timeline for d1v4wc_: