SCOP 1.71: Domain d1v4wc_: 1v4w C:

Lineage for d1v4wc_ (1v4w C:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (19 species)

7. Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [109623] (3 PDB entries)

8. Domain d1v4wc_: 1v4w C: [108361]
   Other proteins in same PDB: d1v4wb_, d1v4wd_
   complexed with ace, hem

Details for d1v4wc_

PDB Entry: 1v4w, 1.7 Å

PDB Description: Crystal structure of bluefin tuna hemoglobin deoxy form at pH7.5

SCOP Domain Sequences for d1v4wc_:

Sequence; same for both SEQRES and ATOM records:

>d1v4wc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Bluefin tuna (Thunnus thynnus)}
ttlsdkdkstvkalwgkisksadaigadalgrmlavypqtktyfshwpdmspgsgpvkah
gkkvmggvalavskiddlttglgdlselhafkmrvdpsnfkilshcilvvvakmfpkeft
pdahvsldkflasvalalaeryr

Timeline for d1v4wc_:

• d1v4wc_ first appeared in SCOP 1.69
  
• d1v4wc_ appears in SCOP 1.73
  
• d1v4wc_ appears in the current release, SCOPe 2.08