Lineage for d1v4wb_ (1v4w B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687026Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [109624] (3 PDB entries)
    Uniprot Q8AYM1
  8. 2687029Domain d1v4wb_: 1v4w B: [108360]
    Other proteins in same PDB: d1v4wa_, d1v4wc_
    complexed with hem

Details for d1v4wb_

PDB Entry: 1v4w (more details), 1.7 Å

PDB Description: Crystal structure of bluefin tuna hemoglobin deoxy form at pH7.5
PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1v4wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4wb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki
aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd
aftvetqcafqkflavvvfalgrkyh

SCOPe Domain Coordinates for d1v4wb_:

Click to download the PDB-style file with coordinates for d1v4wb_.
(The format of our PDB-style files is described here.)

Timeline for d1v4wb_: