![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [109624] (3 PDB entries) Uniprot Q8AYM1 |
![]() | Domain d1v4ud_: 1v4u D: [108358] Other proteins in same PDB: d1v4ua_, d1v4uc_ complexed with cmo, hem |
PDB Entry: 1v4u (more details), 2 Å
SCOPe Domain Sequences for d1v4ud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v4ud_ a.1.1.2 (D:) Hemoglobin, beta-chain {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]} vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd aftvetqcafqkflavvvfalg
Timeline for d1v4ud_: