Lineage for d1v4uc_ (1v4u C:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 530658Protein Hemoglobin, alpha-chain [46486] (19 species)
  7. 530672Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [109623] (3 PDB entries)
  8. 530678Domain d1v4uc_: 1v4u C: [108357]
    Other proteins in same PDB: d1v4ub_, d1v4ud_
    complexed with ace, cmo, hem

Details for d1v4uc_

PDB Entry: 1v4u (more details), 2 Å

PDB Description: Crystal structure of bluefin tuna carbonmonoxy-hemoglobin

SCOP Domain Sequences for d1v4uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4uc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Bluefin tuna (Thunnus thynnus)}
ttlsdkdkstvkalwgkisksadaigadalgrmlavypqtktyfshwpdmspgsgpvkah
gkkvmggvalavskiddlttglgdlselhafkmrvdpsnfkilshcilvvvakmfpkeft
pdahvsldkflasvalalaeryr

SCOP Domain Coordinates for d1v4uc_:

Click to download the PDB-style file with coordinates for d1v4uc_.
(The format of our PDB-style files is described here.)

Timeline for d1v4uc_: