Lineage for d1v4uc_ (1v4u C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686263Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [109623] (3 PDB entries)
    Uniprot Q8AYM0
  8. 2686269Domain d1v4uc_: 1v4u C: [108357]
    Other proteins in same PDB: d1v4ub_, d1v4ud_
    complexed with cmo, hem

Details for d1v4uc_

PDB Entry: 1v4u (more details), 2 Å

PDB Description: Crystal structure of bluefin tuna carbonmonoxy-hemoglobin
PDB Compounds: (C:) hemoglobin alpha chain

SCOPe Domain Sequences for d1v4uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4uc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
ttlsdkdkstvkalwgkisksadaigadalgrmlavypqtktyfshwpdmspgsgpvkah
gkkvmggvalavskiddlttglgdlselhafkmrvdpsnfkilshcilvvvakmfpkeft
pdahvsldkflasvalalaeryr

SCOPe Domain Coordinates for d1v4uc_:

Click to download the PDB-style file with coordinates for d1v4uc_.
(The format of our PDB-style files is described here.)

Timeline for d1v4uc_: