Lineage for d1v4ub_ (1v4u B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2300465Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300490Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [109624] (3 PDB entries)
    Uniprot Q8AYM1
  8. 2300495Domain d1v4ub_: 1v4u B: [108356]
    Other proteins in same PDB: d1v4ua_, d1v4uc_
    complexed with cmo, hem

Details for d1v4ub_

PDB Entry: 1v4u (more details), 2 Å

PDB Description: Crystal structure of bluefin tuna carbonmonoxy-hemoglobin
PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1v4ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4ub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki
aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd
aftvetqcafqkflavvvfalg

SCOPe Domain Coordinates for d1v4ub_:

Click to download the PDB-style file with coordinates for d1v4ub_.
(The format of our PDB-style files is described here.)

Timeline for d1v4ub_: