Lineage for d1v4aa2 (1v4a A:2-286)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2239280Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2239281Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2239700Family d.218.1.9: GlnE-like domain [110933] (1 protein)
    Pfam PF03710; Pfam coverage excludes the extra N-terminal subdomain but includes a short segment of the next domain 2
  6. 2239701Protein Glutamine synthase adenylyltransferase GlnE, N-terminal domain [110934] (1 species)
    includes extra N-terminal all-alpha subdomain (2-61) structurally similar to the PABP domain (63571)
  7. 2239702Species Escherichia coli [TaxId:562] [110935] (1 PDB entry)
    Uniprot P30870 1-437
  8. 2239703Domain d1v4aa2: 1v4a A:2-286 [108351]
    Other proteins in same PDB: d1v4aa1

Details for d1v4aa2

PDB Entry: 1v4a (more details), 2 Å

PDB Description: Structure of the N-terminal Domain of Escherichia coli Glutamine Synthetase adenylyltransferase
PDB Compounds: (A:) Glutamate-ammonia-ligase adenylyltransferase

SCOPe Domain Sequences for d1v4aa2:

Sequence, based on SEQRES records: (download)

>d1v4aa2 d.218.1.9 (A:2-286) Glutamine synthase adenylyltransferase GlnE, N-terminal domain {Escherichia coli [TaxId: 562]}
kplssplqqywqtvverlpeplaeeslsaqaksvltfsdfvqdsviahpewltelesqpp
qadewqhyaawlqealcnvsdeaglmrelrlfrrrimvriawaqtlalvteesilqqlsy
laetlivaardwlydaccrewgtpcnaqgeaqpllilgmgklgggelnfssdidlifawp
ehgctqggrreldnaqfftrmgqrlikvldqptqdgfvyrvdmrlrpfgesgplvlsfaa
ledyyqeqgrdweryamvkarimgdsegvyanelramlrpfvfrr

Sequence, based on observed residues (ATOM records): (download)

>d1v4aa2 d.218.1.9 (A:2-286) Glutamine synthase adenylyltransferase GlnE, N-terminal domain {Escherichia coli [TaxId: 562]}
kplssplqqywqtvverlpeplaeeslsaqaksvltfsdfvqdsviahpewltelesqpp
qadewqhyaawlqealcnvsdeaglmrelrlfrrrimvriawaqtlalvteesilqqlsy
laetlivaardwlydaccrewgtpcnaqgeaqpllilgmgklgggelnfssdidlifawp
ereldnaqfftrmgqrlikvldqptqdgfvyrvdmrlrpfgesgplvlsfaaledyyqeq
grdweryamvkarimgdsegvyanelramlrpfvfrr

SCOPe Domain Coordinates for d1v4aa2:

Click to download the PDB-style file with coordinates for d1v4aa2.
(The format of our PDB-style files is described here.)

Timeline for d1v4aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v4aa1