Lineage for d1v4aa1 (1v4a A:287-437)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700508Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) (S)
  5. 2700573Family a.24.16.4: Glutamine synthase adenylyltransferase GlnE, domain 2 [109767] (1 protein)
    automatically mapped to Pfam PF08335
  6. 2700574Protein Glutamine synthase adenylyltransferase GlnE, domain 2 [109768] (1 species)
  7. 2700575Species Escherichia coli [TaxId:562] [109769] (1 PDB entry)
    Uniprot P30870 1-437
  8. 2700576Domain d1v4aa1: 1v4a A:287-437 [108350]
    Other proteins in same PDB: d1v4aa2

Details for d1v4aa1

PDB Entry: 1v4a (more details), 2 Å

PDB Description: Structure of the N-terminal Domain of Escherichia coli Glutamine Synthetase adenylyltransferase
PDB Compounds: (A:) Glutamate-ammonia-ligase adenylyltransferase

SCOPe Domain Sequences for d1v4aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4aa1 a.24.16.4 (A:287-437) Glutamine synthase adenylyltransferase GlnE, domain 2 {Escherichia coli [TaxId: 562]}
yidfsviqslrnmkgmiarevrrrgltdniklgaggireiefivqvfqlirggrepslqs
rsllptlsaiaelhllsendaeqlrvaylflrrlenllqsindeqtqtlpsdelnrarla
wamdfadwpqltgaltahmtnvrrvfnelig

SCOPe Domain Coordinates for d1v4aa1:

Click to download the PDB-style file with coordinates for d1v4aa1.
(The format of our PDB-style files is described here.)

Timeline for d1v4aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v4aa2