Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins) N-terminal all-beta domain defines family |
Protein Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase [110405] (1 species) |
Species Guinea pig (Cavia porcellus) [TaxId:10141] [110406] (4 PDB entries) Uniprot Q9EQZ5 |
Domain d1v3vb2: 1v3v B:113-294 [108348] Other proteins in same PDB: d1v3va1, d1v3va3, d1v3vb1 complexed with 5op, cl, nap |
PDB Entry: 1v3v (more details), 2 Å
SCOPe Domain Sequences for d1v3vb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v3vb2 c.2.1.1 (B:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} lplslalgtigmpgltayfgllevcgvkggetvlvsaaagavgsvvgqiaklkgckvvga agsdekiaylkqigfdaafnyktvnsleealkkaspdgydcyfdnvggeflntvlsqmkd fgkiaicgaisvynrmdqlppgpspesiiykqlriegfivyrwqgdvrekalrdlmkwvl eg
Timeline for d1v3vb2: