Lineage for d1v3vb2 (1v3v B:113-294)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841344Protein Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase [110405] (1 species)
  7. 2841345Species Guinea pig (Cavia porcellus) [TaxId:10141] [110406] (4 PDB entries)
    Uniprot Q9EQZ5
  8. 2841347Domain d1v3vb2: 1v3v B:113-294 [108348]
    Other proteins in same PDB: d1v3va1, d1v3va3, d1v3vb1
    complexed with 5op, cl, nap

Details for d1v3vb2

PDB Entry: 1v3v (more details), 2 Å

PDB Description: Crystal structure of leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase complexed with NADP and 15-oxo-PGE2
PDB Compounds: (B:) leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase

SCOPe Domain Sequences for d1v3vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3vb2 c.2.1.1 (B:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]}
lplslalgtigmpgltayfgllevcgvkggetvlvsaaagavgsvvgqiaklkgckvvga
agsdekiaylkqigfdaafnyktvnsleealkkaspdgydcyfdnvggeflntvlsqmkd
fgkiaicgaisvynrmdqlppgpspesiiykqlriegfivyrwqgdvrekalrdlmkwvl
eg

SCOPe Domain Coordinates for d1v3vb2:

Click to download the PDB-style file with coordinates for d1v3vb2.
(The format of our PDB-style files is described here.)

Timeline for d1v3vb2: