| Class b: All beta proteins [48724] (178 folds) |
| Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
| Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
| Protein Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase [110175] (1 species) |
| Species Guinea pig (Cavia porcellus) [TaxId:10141] [110176] (4 PDB entries) Uniprot Q9EQZ5 |
| Domain d1v3vb1: 1v3v B:2-112,B:295-329 [108347] Other proteins in same PDB: d1v3va2, d1v3va3, d1v3vb2 complexed with 5op, cl, nap |
PDB Entry: 1v3v (more details), 2 Å
SCOPe Domain Sequences for d1v3vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v3vb1 b.35.1.2 (B:2-112,B:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]}
vkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskrlkega
vmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdkXkiqyhehv
tkgfenmpaafiemlnganlgkavvta
Timeline for d1v3vb1: