Lineage for d1v3vb1 (1v3v B:2-112,B:295-329)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558060Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 558061Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 558147Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 558420Protein Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase [110175] (1 species)
  7. 558421Species Guinea pig (Cavia porcellus) [TaxId:10141] [110176] (3 PDB entries)
  8. 558425Domain d1v3vb1: 1v3v B:2-112,B:295-329 [108347]
    Other proteins in same PDB: d1v3va2, d1v3vb2
    complexed with 5op, cl, nap

Details for d1v3vb1

PDB Entry: 1v3v (more details), 2 Å

PDB Description: Crystal structure of leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase complexed with NADP and 15-oxo-PGE2

SCOP Domain Sequences for d1v3vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3vb1 b.35.1.2 (B:2-112,B:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus)}
vkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskrlkega
vmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdkXkiqyhehv
tkgfenmpaafiemlnganlgkavvta

SCOP Domain Coordinates for d1v3vb1:

Click to download the PDB-style file with coordinates for d1v3vb1.
(The format of our PDB-style files is described here.)

Timeline for d1v3vb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v3vb2