![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (2 families) ![]() |
![]() | Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
![]() | Protein Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase [110175] (1 species) |
![]() | Species Guinea pig (Cavia porcellus) [TaxId:10141] [110176] (3 PDB entries) |
![]() | Domain d1v3ub1: 1v3u B:1-112,B:295-329 [108343] Other proteins in same PDB: d1v3ua2, d1v3ub2 complexed with cl |
PDB Entry: 1v3u (more details), 2 Å
SCOP Domain Sequences for d1v3ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v3ub1 b.35.1.2 (B:1-112,B:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus)} mvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskrlkeg avmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdkXkiqyheh vtkgfenmpaafiemlnganlgkavvta
Timeline for d1v3ub1: