SCOP 1.71: Domain d1v3ub1: 1v3u B:1-112,B:295-329

Lineage for d1v3ub1 (1v3u B:1-112,B:295-329)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase [110175] (1 species)

7. Species Guinea pig (Cavia porcellus) [TaxId:10141] [110176] (3 PDB entries)

8. Domain d1v3ub1: 1v3u B:1-112,B:295-329 [108343]
   Other proteins in same PDB: d1v3ua2, d1v3ub2
   complexed with cl

Details for d1v3ub1

PDB Entry: 1v3u, 2 Å

PDB Description: Crystal structure of leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase in apo form

SCOP Domain Sequences for d1v3ub1:

Sequence; same for both SEQRES and ATOM records:

>d1v3ub1 b.35.1.2 (B:1-112,B:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus)}
mvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskrlkeg
avmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdkXkiqyheh
vtkgfenmpaafiemlnganlgkavvta

Timeline for d1v3ub1:

• d1v3ub1 first appeared in SCOP 1.69
  
• d1v3ub1 appears in SCOP 1.73
  
• d1v3ub1 appears in the current release, SCOPe 2.08