SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1v3tb1 (1v3t B:1-112,B:295-329)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2047809Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2047810Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2047938Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 protein domains)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2048240Protein Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase [110175] (1 species)
  7. 2048241Species Guinea pig (Cavia porcellus) [TaxId:10141] [110176] (4 PDB entries)
    Uniprot Q9EQZ5
  8. 2048249Domain d1v3tb1: 1v3t B:1-112,B:295-329 [108339]
    Other proteins in same PDB: d1v3ta2, d1v3ta3, d1v3tb2, d1v3tb3
    complexed with nap

Details for d1v3tb1

PDB Entry: 1v3t (more details), 2.3 Å

PDB Description: Crystal structure of leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase
PDB Compounds: (B:) leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase

SCOPe Domain Sequences for d1v3tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3tb1 b.35.1.2 (B:1-112,B:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]}
mvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskrlkeg
avmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdkXkiqyheh
vtkgfenmpaafiemlnganlgkavvta

SCOPe Domain Coordinates for d1v3tb1:

Click to download the PDB-style file with coordinates for d1v3tb1.
(The format of our PDB-style files is described here.)

Timeline for d1v3tb1: