Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) automatically mapped to Pfam PF00686 |
Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (8 PDB entries) Uniprot P05618 |
Domain d1v3mb2: 1v3m B:583-686 [108334] Other proteins in same PDB: d1v3ma1, d1v3ma3, d1v3ma4, d1v3mb1, d1v3mb3, d1v3mb4 complexed with aci, ca, gal, glc; mutant |
PDB Entry: 1v3m (more details), 2 Å
SCOPe Domain Sequences for d1v3mb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v3mb2 b.3.1.1 (B:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011 [TaxId: 1409]} tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp
Timeline for d1v3mb2:
View in 3D Domains from other chains: (mouse over for more information) d1v3ma1, d1v3ma2, d1v3ma3, d1v3ma4 |