SCOPe 2.08: Domain d1v3ma3: 1v3m A:407-496

Lineage for d1v3ma3 (1v3m A:407-496)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries)
   Uniprot P05618

8. Domain d1v3ma3: 1v3m A:407-496 [108331]
   Other proteins in same PDB: d1v3ma1, d1v3ma2, d1v3ma4, d1v3mb1, d1v3mb2, d1v3mb4
   complexed with aci, ca, gal, glc; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d1v3ma3

PDB Entry: 1v3m, 2 Å

PDB Description: crystal structure of f283y mutant cyclodextrin glycosyltransferase complexed with a pseudo-tetraose derived from acarbose

PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1v3ma3:

Sequence; same for both SEQRES and ATOM records:

>d1v3ma3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011 [TaxId: 1409]}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda

Timeline for d1v3ma3:

• d1v3ma3 first appeared in SCOP 1.69
  
• d1v3ma3 appears in SCOPe 2.07