Class b: All beta proteins [48724] (144 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries) |
Domain d1v3lb3: 1v3l B:407-496 [108327] Other proteins in same PDB: d1v3la1, d1v3la2, d1v3la4, d1v3lb1, d1v3lb2, d1v3lb4 |
PDB Entry: 1v3l (more details), 2.1 Å
SCOP Domain Sequences for d1v3lb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v3lb3 b.71.1.1 (B:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011} gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng ntltvgaggaasnftlapggtavwqyttda
Timeline for d1v3lb3:
View in 3D Domains from other chains: (mouse over for more information) d1v3la1, d1v3la2, d1v3la3, d1v3la4 |