Lineage for d1v3lb3 (1v3l B:407-496)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810494Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 2810536Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries)
    Uniprot P05618
  8. 2810544Domain d1v3lb3: 1v3l B:407-496 [108327]
    Other proteins in same PDB: d1v3la1, d1v3la2, d1v3la4, d1v3lb1, d1v3lb2, d1v3lb4
    complexed with aci, ca, glc; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1v3lb3

PDB Entry: 1v3l (more details), 2.1 Å

PDB Description: crystal structure of f283l mutant cyclodextrin glycosyltransferase complexed with a pseudo-tetraose derived from acarbose
PDB Compounds: (B:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1v3lb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3lb3 b.71.1.1 (B:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011 [TaxId: 1409]}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda

SCOPe Domain Coordinates for d1v3lb3:

Click to download the PDB-style file with coordinates for d1v3lb3.
(The format of our PDB-style files is described here.)

Timeline for d1v3lb3: