Lineage for d1v3lb2 (1v3l B:583-686)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768599Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2768632Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 2768674Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (8 PDB entries)
    Uniprot P05618
  8. 2768682Domain d1v3lb2: 1v3l B:583-686 [108326]
    Other proteins in same PDB: d1v3la1, d1v3la3, d1v3la4, d1v3lb1, d1v3lb3, d1v3lb4
    complexed with aci, ca, glc; mutant

Details for d1v3lb2

PDB Entry: 1v3l (more details), 2.1 Å

PDB Description: crystal structure of f283l mutant cyclodextrin glycosyltransferase complexed with a pseudo-tetraose derived from acarbose
PDB Compounds: (B:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1v3lb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3lb2 b.3.1.1 (B:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011 [TaxId: 1409]}
tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv
pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp

SCOPe Domain Coordinates for d1v3lb2:

Click to download the PDB-style file with coordinates for d1v3lb2.
(The format of our PDB-style files is described here.)

Timeline for d1v3lb2: