Lineage for d1v3la3 (1v3l A:407-496)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 469403Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 469404Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 469405Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 469518Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 469560Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries)
  8. 469575Domain d1v3la3: 1v3l A:407-496 [108323]
    Other proteins in same PDB: d1v3la1, d1v3la2, d1v3la4, d1v3lb1, d1v3lb2, d1v3lb4

Details for d1v3la3

PDB Entry: 1v3l (more details), 2.1 Å

PDB Description: crystal structure of f283l mutant cyclodextrin glycosyltransferase complexed with a pseudo-tetraose derived from acarbose

SCOP Domain Sequences for d1v3la3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3la3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda

SCOP Domain Coordinates for d1v3la3:

Click to download the PDB-style file with coordinates for d1v3la3.
(The format of our PDB-style files is described here.)

Timeline for d1v3la3: