| Class b: All beta proteins [48724] (165 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
| Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries) |
| Domain d1v3kb3: 1v3k B:407-496 [108319] Other proteins in same PDB: d1v3ka1, d1v3ka2, d1v3ka4, d1v3kb1, d1v3kb2, d1v3kb4 complexed with ca; mutant |
PDB Entry: 1v3k (more details), 2 Å
SCOP Domain Sequences for d1v3kb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v3kb3 b.71.1.1 (B:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011 [TaxId: 1409]}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda
Timeline for d1v3kb3:
View in 3DDomains from other chains: (mouse over for more information) d1v3ka1, d1v3ka2, d1v3ka3, d1v3ka4 |