SCOP 1.71: Domain d1v3kb1: 1v3k B:497-582

Lineage for d1v3kb1 (1v3k B:497-582)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (18 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
   follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases

7. Species Bacillus sp., strain 1011 [TaxId:1409] [49219] (8 PDB entries)

8. Domain d1v3kb1: 1v3k B:497-582 [108317]
   Other proteins in same PDB: d1v3ka2, d1v3ka3, d1v3ka4, d1v3kb2, d1v3kb3, d1v3kb4
   complexed with ca; mutant

Details for d1v3kb1

PDB Entry: 1v3k, 2 Å

PDB Description: crystal structure of f283y mutant cyclodextrin glycosyltransferase

SCOP Domain Sequences for d1v3kb1:

Sequence; same for both SEQRES and ATOM records:

>d1v3kb1 b.1.18.2 (B:497-582) Cyclomaltodextrin glycanotransferase, domain D {Bacillus sp., strain 1011}
ttpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgadivawedtqiqvkipav
pggiydirvanaagaasniydnfevl

Timeline for d1v3kb1:

• d1v3kb1 first appeared in SCOP 1.69
  
• d1v3kb1 appears in SCOP 1.73
  
• d1v3kb1 appears in the current release, SCOPe 2.08