SCOP 1.71: Domain d1v3jb4: 1v3j B:1-406

Lineage for d1v3jb4 (1v3j B:1-406)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (13 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Cyclodextrin glycosyltransferase [51452] (5 species)
   contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like

7. Species Alkalophilic bacillus sp., strain 1011 [51456] (8 PDB entries)

8. Domain d1v3jb4: 1v3j B:1-406 [108312]
   Other proteins in same PDB: d1v3ja1, d1v3ja2, d1v3ja3, d1v3jb1, d1v3jb2, d1v3jb3
   complexed with ca; mutant

Details for d1v3jb4

PDB Entry: 1v3j, 2 Å

PDB Description: crystal structure of f283l mutant cyclodextrin glycosyltransferase

SCOP Domain Sequences for d1v3jb4:

Sequence; same for both SEQRES and ATOM records:

>d1v3jb4 c.1.8.1 (B:1-406) Cyclodextrin glycosyltransferase {Alkalophilic bacillus sp., strain 1011}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
sfmatinnykpvftfgewflgvneispeyhqfanesgmslldlrfaqkarqvfrdntdnm
yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay

Timeline for d1v3jb4:

• d1v3jb4 first appeared in SCOP 1.69
  
• d1v3jb4 appears in SCOP 1.73
  
• d1v3jb4 appears in the current release, SCOPe 2.08