Lineage for d1v3ja3 (1v3j A:407-496)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566044Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 566045Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 566046Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 566166Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 566208Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries)
  8. 566219Domain d1v3ja3: 1v3j A:407-496 [108307]
    Other proteins in same PDB: d1v3ja1, d1v3ja2, d1v3ja4, d1v3jb1, d1v3jb2, d1v3jb4

Details for d1v3ja3

PDB Entry: 1v3j (more details), 2 Å

PDB Description: crystal structure of f283l mutant cyclodextrin glycosyltransferase

SCOP Domain Sequences for d1v3ja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3ja3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda

SCOP Domain Coordinates for d1v3ja3:

Click to download the PDB-style file with coordinates for d1v3ja3.
(The format of our PDB-style files is described here.)

Timeline for d1v3ja3: